PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g16480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 112aa    MW: 12718.7 Da    PI: 6.7677
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g16480.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP57.24.6e-18547244
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-T CS
              SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCq 44
                     Cqv++C+adlseak+yhrrhkvCe h+k  +v ++gl+qr  q
  Vradi07g16480.1  5 CQVDNCDADLSEAKQYHRRHKVCEYHAKVHSVHMAGLQQRLQQ 47
                     ****************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114112.973275IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.108.2E-19247IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.46E-17347IPR004333Transcription factor, SBP-box
PfamPF031103.2E-13545IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MPPSCQVDNC DADLSEAKQY HRRHKVCEYH AKVHSVHMAG LQQRLQQLTF LEKFCFSDSM  60
SCLNLMNQKG VVEHVWLVIT RGDAKMQLTI VESNFFVVTM NINSLEASIC D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-135471153squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150342e-78AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007159344.17e-51hypothetical protein PHAVU_002G230300g
TrEMBLV7CPQ37e-51V7CPQ3_PHAVU; Uncharacterized protein
STRINGGLYMA07G31880.17e-24(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2269134
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.23e-15squamosa promoter binding protein-like 8